PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01677.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family G2-like
Protein Properties Length: 325aa    MW: 35799 Da    PI: 8.573
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01677.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32183238156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  Rsa1.0_01677.1_g00004.1 183 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 238
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.55E-18180241IPR009057Homeodomain-like
PROSITE profilePS5129415.086180240IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-28181241IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26183238IPR006447Myb domain, plants
PfamPF002494.9E-8185236IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MQRCHEYVEA LKEEQKKIQV FQRELPLCLE LVTQAIEACK KELSGTSTTS SEQCNSEQTA  60
SVCGGPVLEE FIPIKKSNDG EHESPREIEK SDVDSKKSDW LRSAHLWNHS PDPDTTVVAE  120
VAAAKKARVV EVKPNSNNRC GFQPFQKETK RVFPEPEPEP APAPAATTCS TTGREQQSQT  180
HRKQRRCWSP ELHRRFLHAL QQLGGSHVAT PKQIRDHMKV DGLTNDEVKS HLQKYRLHTR  240
RPATAQGNGN SQQPQFVVVG GIWVPSPQDF PPPSNVANSS GGVCTPVTAQ PPKSPKRSVE  300
RSSGRCNSPA ASSSTNTTTT SSPVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0638861e-64AY063886.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
GenBankAY0879931e-64AY087993.1 Arabidopsis thaliana clone 40196 mRNA, complete sequence.
GenBankAY0912411e-64AY091241.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013702676.11e-166PREDICTED: uncharacterized protein LOC106406536
TrEMBLA0A078E9F11e-164A0A078E9F1_BRANA; BnaA07g27330D protein
STRINGBra004330.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-123G2-like family protein